Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTR3B Peptide - N-terminal region

ACTR3B Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARP11, ARP3BETA, DKFZp686O24114

UniProt

Q9P1U1

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTR3B Rabbit Polyclonal Antibody (orb583560) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065178

Preservative

Lyophilized powder

AA Sequence

MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 S protein RBD (N501Y), Fc Tag (MALS verified)
SPD-C5253-100ug 100 µg

SARS-CoV-2 S protein RBD (N501Y), Fc Tag (MALS verified)

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), 0.2mg/mL
BNUB1880-500 1x 500 µL

Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), 0.2mg/mL

Sign In for Pricing
View Details
Mouse Atp5k activation kit by CRISPRa
GA200331 1 Kit

Mouse Atp5k activation kit by CRISPRa

Sign In for Pricing
View Details
6PPD-quinone
TRC-P348790-50MG 50 mg

6PPD-quinone

Sign In for Pricing
View Details
1700016C15Rik Mouse Gene Knockout Kit (CRISPR)
KN500091 1 Kit

1700016C15Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MPO Antibody
KC-2763-01 50 μL

MPO Antibody

Sign In for Pricing
View Details