Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTR3B Peptide - N-terminal region

ACTR3B Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARP11, ARP3BETA, DKFZp686O24114

UniProt

Q9P1U1

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTR3B Rabbit Polyclonal Antibody (orb583560) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065178

Preservative

Lyophilized powder

AA Sequence

MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetyl L-Carnitine-13C3 Chloride
TRC-A171991-250MG 250 mg

Acetyl L-Carnitine-13C3 Chloride

Sign In for Pricing
View Details
PGA3 (C-term) Rabbit Polyclonal Antibody
AP53267PU-N 400 µL

PGA3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human LCN8 activation kit by CRISPRa
GA115306 1 Kit

Human LCN8 activation kit by CRISPRa

Sign In for Pricing
View Details
GGA1 (NM_001172688) Human Over-expression Lysate
LC433284 20 µg

GGA1 (NM_001172688) Human Over-expression Lysate

Sign In for Pricing
View Details
FUT4 Human Gene Knockout Kit (CRISPR)
KN423829 1 Kit

FUT4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), Biotin conjugate, 0.1mg/mL
BNCB1387-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details