Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTR3B Peptide - N-terminal region

ACTR3B Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARP11, ARP3BETA, DKFZp686O24114

UniProt

Q9P1U1

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTR3B Rabbit Polyclonal Antibody (orb583561) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065178

Preservative

Lyophilized powder

AA Sequence

DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SOCS3 Antibody
STJ503080 100 µg

Anti-SOCS3 Antibody

Sign In for Pricing
View Details
MMACHC Protein Vector (Mouse) (pPM-C-HA)
PV201208 500 ng

MMACHC Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Nop14 (C-3) : m-IgG Fc BP-HRP Bundle
sc-538510 1 Kit

Nop14 (C-3) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
pCMV-SPORT6-ELN Plasmid
PVT22792 2 µg

pCMV-SPORT6-ELN Plasmid

Sign In for Pricing
View Details
HCN2 (NM_001194) Human Tagged ORF Clone
RC214036 10 µg

HCN2 (NM_001194) Human Tagged ORF Clone

Sign In for Pricing
View Details
Goat Peptide YY ELISA kit
GTR10419554 96 Well

Goat Peptide YY ELISA kit

Sign In for Pricing
View Details