Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTR3B Peptide - N-terminal region

ACTR3B Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARP11, ARP3BETA, DKFZp686O24114

UniProt

Q9P1U1

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTR3B Rabbit Polyclonal Antibody (orb583561) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065178

Preservative

Lyophilized powder

AA Sequence

DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpl36 (NM_022504) Rat Untagged Clone
RN207260 10 µg

Rpl36 (NM_022504) Rat Untagged Clone

Sign In for Pricing
View Details
OR10V1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1555202 1.0 µg DNA

OR10V1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
LGALS7 Antibody
orb253227 100 µL

LGALS7 Antibody

Sign In for Pricing
View Details
PVAX1-GPX4 Plasmid
PVT66736 2 µg

PVAX1-GPX4 Plasmid

Sign In for Pricing
View Details
Hsa-miR-1260b miRNA Antagomir
orb1915354-01 10 nmol

Hsa-miR-1260b miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-1260b miRNA Antagomir
orb1915354-02 20 nmol

Hsa-miR-1260b miRNA Antagomir

Sign In for Pricing
View Details