ACTRT1 Peptide - middle region
ACTRT1 Peptide - middle region
Product Specifications
Product Name Alternative
AIP1, ARIP1, ARP-T1, ARPT1, HSD27, KIAA0705, MGC26590
UniProt
Q8TDG2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACTRT1 Rabbit Polyclonal Antibody (orb330692) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_612146
Preservative
Lyophilized powder
AA Sequence
DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1651946-01 20 µg
Recombinant Human V-type proton ATPase subunit G 1 (ATP6V1G1)
Sign In for Pricing
View Details 
orb1651946-02 100 µg
Recombinant Human V-type proton ATPase subunit G 1 (ATP6V1G1)
Sign In for Pricing
View Details 
orb1651946-03 1 mg
Recombinant Human V-type proton ATPase subunit G 1 (ATP6V1G1)
Sign In for Pricing
View Details K6827006 1.0 µg DNA
Ces1c sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details 