ACTRT1 Peptide - middle region
ACTRT1 Peptide - middle region
Product Specifications
Product Name Alternative
AIP1, ARIP1, ARP-T1, ARPT1, HSD27, KIAA0705, MGC26590
UniProt
Q8TDG2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACTRT1 Rabbit Polyclonal Antibody (orb330692) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_612146
Preservative
Lyophilized powder
AA Sequence
DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Lsx5356-50gEcoli 50 µg (E. coli)
Recombinant Brucella Canis omp25 Protein (aa 24-213)
Sign In for Pricing
View Details MBS7202592-01 48 Well
Chicken Acyl-coenzyme A thioesterase 12 (ACOT12) ELISA Kit
Sign In for Pricing
View Details MBS7202592-02 96 Well
Chicken Acyl-coenzyme A thioesterase 12 (ACOT12) ELISA Kit
Sign In for Pricing
View Details MBS7202592-03 5x 96 Well
Chicken Acyl-coenzyme A thioesterase 12 (ACOT12) ELISA Kit
Sign In for Pricing
View Details MBS7202592-04 10x 96 Well
Chicken Acyl-coenzyme A thioesterase 12 (ACOT12) ELISA Kit
Sign In for Pricing
View Details