Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADA Peptide - N-terminal region

ADA Peptide - N-terminal region

Product Specifications

UniProt

P00813

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADA Rabbit Polyclonal Antibody (orb581431) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000013

Preservative

Lyophilized powder

AA Sequence

AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR4M2 Polyclonal Antibody
JOT-AP12489-01 20 µL

OR4M2 Polyclonal Antibody

Sign In for Pricing
View Details
OR4M2 Polyclonal Antibody
JOT-AP12489-02 50 μL

OR4M2 Polyclonal Antibody

Sign In for Pricing
View Details
OR4M2 Polyclonal Antibody
JOT-AP12489-03 100 µL

OR4M2 Polyclonal Antibody

Sign In for Pricing
View Details
RPLP0 Polyclonal Antibody
CAC13912-01 50 µg

RPLP0 Polyclonal Antibody

Sign In for Pricing
View Details
RPLP0 Polyclonal Antibody
CAC13912-02 100 µg

RPLP0 Polyclonal Antibody

Sign In for Pricing
View Details
DOM3Z shRNA Plasmid (h)
sc-95321-SH 20 µg

DOM3Z shRNA Plasmid (h)

Sign In for Pricing
View Details