Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adam29 Peptide - N-terminal region

Adam29 Peptide - N-terminal region

Product Specifications

UniProt

Q811Q4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Adam29 Rabbit Polyclonal Antibody (orb579929) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_787953

Preservative

Lyophilized powder

AA Sequence

DYPFVQDDCYYQGYVEGDSESLVSLSSCFGGFHGLLEINNIVYEIMPKKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UQCRH Rabbit mAb
E45R11532N-50 50 µL

UQCRH Rabbit mAb

Sign In for Pricing
View Details
VPRBP/DCAF1 Rabbit Polyclonal Antibody (APC)
orb2600172 100 µg

VPRBP/DCAF1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
TPH1 Polyclonal Antibody
E20-74709 100 µg

TPH1 Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-MYPT1 (Thr696) Rabbit Polyclonal Antibody (BF680)
orb1609410 100 µL

Phospho-MYPT1 (Thr696) Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O8 (strain IAI1) ISCA Polyclonal Antibody
MBS7177791 Inquire

Rabbit anti-Escherichia coli O8 (strain IAI1) ISCA Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Prion Protein ELISA Kit (PRNP)
RK03137 96 Tests

Mouse Prion Protein ELISA Kit (PRNP)

Sign In for Pricing
View Details