Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adam29 Peptide - N-terminal region

Adam29 Peptide - N-terminal region

Product Specifications

UniProt

Q811Q4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Adam29 Rabbit Polyclonal Antibody (orb579929) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_787953

Preservative

Lyophilized powder

AA Sequence

DYPFVQDDCYYQGYVEGDSESLVSLSSCFGGFHGLLEINNIVYEIMPKKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHGR1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
36585061 1.0 µg DNA

PHGR1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rat Elastase 4 (ELA4) ELISA Kit
orb1949177-01 48 Tests

Rat Elastase 4 (ELA4) ELISA Kit

Sign In for Pricing
View Details
Rat Elastase 4 (ELA4) ELISA Kit
orb1949177-02 96 Tests

Rat Elastase 4 (ELA4) ELISA Kit

Sign In for Pricing
View Details
VO-Ohpic trihydrate
T7012-01 1 mL - 10 mM (in DMSO)

VO-Ohpic trihydrate

Sign In for Pricing
View Details
VO-Ohpic trihydrate
T7012-02 5 mg

VO-Ohpic trihydrate

Sign In for Pricing
View Details
VO-Ohpic trihydrate
T7012-03 10 mg

VO-Ohpic trihydrate

Sign In for Pricing
View Details