ADAM8 Peptide - N-terminal region
ADAM8 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CD156, MGC134985, MS2
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ADAM8 Rabbit Polyclonal Antibody (orb584516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001100
Preservative
Lyophilized powder
AA Sequence
LHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPDSAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog