Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAM8 Peptide - N-terminal region

ADAM8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD156, MGC134985, MS2

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAM8 Rabbit Polyclonal Antibody (orb584516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100

Preservative

Lyophilized powder

AA Sequence

LHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPDSAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTER3 Rabbit Polyclonal Antibody
BT-AP11403-01 20 µL

MTER3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MTER3 Rabbit Polyclonal Antibody
BT-AP11403-02 50 µL

MTER3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MTER3 Rabbit Polyclonal Antibody
BT-AP11403-03 100 µL

MTER3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL-6Rα/CD126 (E5B3P) Rabbit Monoclonal Antibody
CST 18935S 100 µL

IL-6Rα/CD126 (E5B3P) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Benzo[d]oxazol-5-ylmethanol
OR1005235 1 Each

Benzo[d]oxazol-5-ylmethanol

Sign In for Pricing
View Details
FGFBP1 Antibody
A55937-100UL 100 µL

FGFBP1 Antibody

Sign In for Pricing
View Details