Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAM8 Peptide - N-terminal region

ADAM8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD156, MGC134985, MS2

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAM8 Rabbit Polyclonal Antibody (orb584516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100

Preservative

Lyophilized powder

AA Sequence

LHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPDSAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRF Recombinant Protein
OPCD07716-200UG 200 µg

TRF Recombinant Protein

Sign In for Pricing
View Details
Bovine Neurotrophin 4 (NT4) ELISA KIT
MBS2609577-01 48 Well

Bovine Neurotrophin 4 (NT4) ELISA KIT

Sign In for Pricing
View Details
Bovine Neurotrophin 4 (NT4) ELISA KIT
MBS2609577-02 96 Well

Bovine Neurotrophin 4 (NT4) ELISA KIT

Sign In for Pricing
View Details
Bovine Neurotrophin 4 (NT4) ELISA KIT
MBS2609577-03 5x 96 Well

Bovine Neurotrophin 4 (NT4) ELISA KIT

Sign In for Pricing
View Details
Bovine Neurotrophin 4 (NT4) ELISA KIT
MBS2609577-04 10x 96 Well

Bovine Neurotrophin 4 (NT4) ELISA KIT

Sign In for Pricing
View Details
NDUFA4 siRNA (Human)
MBS8240384-01 15 nmol

NDUFA4 siRNA (Human)

Sign In for Pricing
View Details