Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAT3 Peptide - C-terminal region

ADAT3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FWP005, MST121, MSTP121, S863-5, TAD3

UniProt

Q96EY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAT3 Rabbit Polyclonal Antibody (orb585335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612431

Preservative

Lyophilized powder

AA Sequence

RPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDLYVTREPCAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC37A3 siRNA Oligos set (Human)
44164171 3x 5 nmol

SLC37A3 siRNA Oligos set (Human)

Sign In for Pricing
View Details
EFNA2 Antibody
MBS9604491-01 0.1 mL

EFNA2 Antibody

Sign In for Pricing
View Details
EFNA2 Antibody
MBS9604491-02 0.2 mL

EFNA2 Antibody

Sign In for Pricing
View Details
EFNA2 Antibody
MBS9604491-03 5x 0.2 mL

EFNA2 Antibody

Sign In for Pricing
View Details
Nek7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4470908 1.0 µg DNA

Nek7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Il11ra2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3832608 1.0 µg DNA

Il11ra2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details