Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAT3 Peptide - C-terminal region

ADAT3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FWP005, MST121, MSTP121, S863-5, TAD3

UniProt

Q96EY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAT3 Rabbit Polyclonal Antibody (orb585335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612431

Preservative

Lyophilized powder

AA Sequence

RPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDLYVTREPCAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLIS3 (NM_001042413) Human Over-expression Lysate
LS169792-100ug 100 µg

GLIS3 (NM_001042413) Human Over-expression Lysate

Sign In for Pricing
View Details
SRF (Serum Response Factor (c-fos Serum Response Element-Binding Transcription Factor), MCM1) (AP)
MBS6162451-01 0.1 mL

SRF (Serum Response Factor (c-fos Serum Response Element-Binding Transcription Factor), MCM1) (AP)

Sign In for Pricing
View Details
SRF (Serum Response Factor (c-fos Serum Response Element-Binding Transcription Factor), MCM1) (AP)
MBS6162451-02 5x 0.1 mL

SRF (Serum Response Factor (c-fos Serum Response Element-Binding Transcription Factor), MCM1) (AP)

Sign In for Pricing
View Details
LRRC8A, CT (LRRC8A, KIAA1437, LRRC8, Leucine-rich repeat-containing protein 8A) (MaxLight 550) discontinued
037975-ML550 100 µL

LRRC8A, CT (LRRC8A, KIAA1437, LRRC8, Leucine-rich repeat-containing protein 8A) (MaxLight 550) discontinued

Sign In for Pricing
View Details
ST3GAL3 (NM_174971) Human Tagged ORF Clone Lentiviral Particle
RC223516L3V 200 µL

ST3GAL3 (NM_174971) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Trans-4'-Propylbi (cyclohexan) -4-one
sc-331940A 5 g

Trans-4'-Propylbi (cyclohexan) -4-one

Sign In for Pricing
View Details