Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADCY2 Peptide - middle region

ADCY2 Peptide - middle region

Product Specifications

Product Name Alternative

AC2, FLJ16822, FLJ45092, HBAC2, KIAA1060, MGC133314

UniProt

Q08462

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADCY2 Rabbit Polyclonal Antibody (orb580769) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065433

Preservative

Lyophilized powder

AA Sequence

FLSDSEETIPPTANTTNTSFSASNNQVAILRAQNLFFLPYFIYSCILGLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Visfatin/NAMPT Antibody Picoband® (Dylight488 Conjugate)
PB10009-Dylight488 100 µg

Anti-Visfatin/NAMPT Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
CFHR1 Antibody
orb2676329-01 50 µL

CFHR1 Antibody

Sign In for Pricing
View Details
CFHR1 Antibody
orb2676329-02 100 µL

CFHR1 Antibody

Sign In for Pricing
View Details
CFHR1 Antibody
orb2676329-03 200 µL

CFHR1 Antibody

Sign In for Pricing
View Details
E2EPF Antibody Blocking peptide
orb1451110 500 µg

E2EPF Antibody Blocking peptide

Sign In for Pricing
View Details
Lentiviral human AAMDC sgRNA gene knockout kit - Lentiviral human AAMDC sgRNA gene knockout kit (plasmid)
GTR15356933 1 Vial

Lentiviral human AAMDC sgRNA gene knockout kit - Lentiviral human AAMDC sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details