ADCY2 Peptide - middle region
ADCY2 Peptide - middle region
Product Specifications
Product Name Alternative
AC2, FLJ16822, FLJ45092, HBAC2, KIAA1060, MGC133314
UniProt
Q08462
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ADCY2 Rabbit Polyclonal Antibody (orb580769) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065433
Preservative
Lyophilized powder
AA Sequence
FLSDSEETIPPTANTTNTSFSASNNQVAILRAQNLFFLPYFIYSCILGLI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M9520-13B-Biotin 100 µL
Muscarinic Acetylcholine Receptor M2, aa225-359 (Chrm2, CHRM-2, 7TM Receptor, FLJ43243, HM2, MGC120006, MGC120007) (Biotin)
Sign In for Pricing
View Details 
MBS2072632-01 0.1 mL
Cy3-Linked Polyclonal Antibody to Killer Cell Immunoglobulin Like Receptor 2DS2 (KIR2DS2)
Sign In for Pricing
View Details MBS2072632-02 0.2 mL
Cy3-Linked Polyclonal Antibody to Killer Cell Immunoglobulin Like Receptor 2DS2 (KIR2DS2)
Sign In for Pricing
View Details MBS2072632-03 0.5 mL
Cy3-Linked Polyclonal Antibody to Killer Cell Immunoglobulin Like Receptor 2DS2 (KIR2DS2)
Sign In for Pricing
View Details