Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADD3 Peptide - middle region

ADD3 Peptide - middle region

Product Specifications

Product Name Alternative

ADDL

UniProt

Q9UEY8

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADD3 Rabbit Polyclonal Antibody (orb584520) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IF, WB

NCBI Accession Number

NP_058432

Preservative

Lyophilized powder

AA Sequence

AYYDYQGSLEEQEERIQLQKVLGPSCKVLVLRNHGVVALGETLEEAFHYI

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ras related protein Rab 8A (RAB8A) ELISA Kit
GTR10361030 96 Well

Human Ras related protein Rab 8A (RAB8A) ELISA Kit

Sign In for Pricing
View Details
GENLISA™ Human Supervillin (SVIL) ELISA
KBH6233 1x 96 Well

GENLISA™ Human Supervillin (SVIL) ELISA

Sign In for Pricing
View Details
Adenosine A3 Receptor Rabbit Polyclonal Antibody (PE)
orb2423154 100 µL

Adenosine A3 Receptor Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Rabbit Monoclonal CD19 Antibody (HD37) [Alexa Fluor 750]
NBP2-52662AF750 0.1 mL

Rabbit Monoclonal CD19 Antibody (HD37) [Alexa Fluor 750]

Sign In for Pricing
View Details
WIF1 Rabbit Polyclonal Antibody
TA372040 100 µL

WIF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal PFDN2 Antibody (04) [Alexa Fluor 488]
NBP3-06549AF488 0.1 mL

Mouse Monoclonal PFDN2 Antibody (04) [Alexa Fluor 488]

Sign In for Pricing
View Details