Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADD3 Peptide - middle region

ADD3 Peptide - middle region

Product Specifications

Product Name Alternative

ADDL

UniProt

Q9UEY8

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADD3 Rabbit Polyclonal Antibody (orb584520) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IF, WB

NCBI Accession Number

NP_058432

Preservative

Lyophilized powder

AA Sequence

AYYDYQGSLEEQEERIQLQKVLGPSCKVLVLRNHGVVALGETLEEAFHYI

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIP2A Protein Vector (Rat) (pPM-C-HA)
PV264096 500 ng

DIP2A Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Anti Human F11R Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (IHC,ELISA) 200ul
IRBAHUF11RAAP216200UL 200 µL

Rabbit Anti Human F11R Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (IHC,ELISA) 200ul

Sign In for Pricing
View Details
Human STARD3NL Pre-designed siRNA Set A
SI015893A 1 Each

Human STARD3NL Pre-designed siRNA Set A

Sign In for Pricing
View Details
Tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase
336566 100 µL

Tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida pth Protein (aa 1-194)
VAng-Cr7227-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida pth Protein (aa 1-194)

Sign In for Pricing
View Details
Boc- (R) -3-amino-3- (4-cyanophenyl) propionic acid
sc-293567A 250 mg

Boc- (R) -3-amino-3- (4-cyanophenyl) propionic acid

Sign In for Pricing
View Details