Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADIPOR2 Peptide - N-terminal region

ADIPOR2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ACDCR2, FLJ21432, MGC4640, PAQR2

UniProt

Q86V24

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADIPOR2 Rabbit Polyclonal Antibody (orb584818) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078827

Preservative

Lyophilized powder

AA Sequence

ASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK1940029 10mM * 1mL in DMSO
A20820-10mM-D 10 mM x 1mL in DMSO

GSK1940029 10mM * 1mL in DMSO

Sign In for Pricing
View Details
LMO2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV711974 1.0 µg DNA

LMO2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Polyclonal Antibody to Toll Like Receptor 6 (TLR6)
MBS2014339-01 0.1 mL

Polyclonal Antibody to Toll Like Receptor 6 (TLR6)

Sign In for Pricing
View Details
Polyclonal Antibody to Toll Like Receptor 6 (TLR6)
MBS2014339-02 0.2 mL

Polyclonal Antibody to Toll Like Receptor 6 (TLR6)

Sign In for Pricing
View Details
Polyclonal Antibody to Toll Like Receptor 6 (TLR6)
MBS2014339-03 0.5 mL

Polyclonal Antibody to Toll Like Receptor 6 (TLR6)

Sign In for Pricing
View Details
Polyclonal Antibody to Toll Like Receptor 6 (TLR6)
MBS2014339-04 1 mL

Polyclonal Antibody to Toll Like Receptor 6 (TLR6)

Sign In for Pricing
View Details