Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADORA2A Peptide - N-terminal region

ADORA2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

ADORA2, RDC8, hA2aR

UniProt

P29274

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADORA2A Rabbit Polyclonal Antibody (orb584521) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000666

Preservative

Lyophilized powder

AA Sequence

SFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P/P049/NT/PE-DIA25-7 Prohibited Activity Signs & Labels (Adhesive)
239119 7 Pack (7 Panel (s) x 1 Sheet)

P/P049/NT/PE-DIA25-7 Prohibited Activity Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Rabbit Polyclonal Aquaporin-5 Antibody
NBP3-12286 100 µg

Rabbit Polyclonal Aquaporin-5 Antibody

Sign In for Pricing
View Details
Fish Chemokine C-C-Motif Receptor 10 ELISA Kit
MBS077836 Inquire

Fish Chemokine C-C-Motif Receptor 10 ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Mammaglobin B Antibody
MBS4506311-01 0.05 mL

Rabbit anti-Mammaglobin B Antibody

Sign In for Pricing
View Details
Rabbit anti-Mammaglobin B Antibody
MBS4506311-02 0.1 mL

Rabbit anti-Mammaglobin B Antibody

Sign In for Pricing
View Details
Rabbit anti-Mammaglobin B Antibody
MBS4506311-03 5x 0.1 mL

Rabbit anti-Mammaglobin B Antibody

Sign In for Pricing
View Details