Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADORA2B Peptide - C-terminal region

ADORA2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

ADORA2

UniProt

P29275

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADORA2B Rabbit Polyclonal Antibody (orb331074) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000667

Preservative

Lyophilized powder

AA Sequence

THGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vav1 (NM_011691) Mouse Recombinant Protein
E45M42508M5 20 µg

Vav1 (NM_011691) Mouse Recombinant Protein

Sign In for Pricing
View Details
Alpelisib-d9
CS-O-44723 1 Each

Alpelisib-d9

Sign In for Pricing
View Details
Tropomyosin 1 Rabbit mAb
RDSA67759 100 µL

Tropomyosin 1 Rabbit mAb

Sign In for Pricing
View Details
Bpifb2 Mouse shRNA Plasmid (Locus ID 66557)
TL503659 1 Kit

Bpifb2 Mouse shRNA Plasmid (Locus ID 66557)

Sign In for Pricing
View Details
HA1 (H3N2) (A/Sydney/5/97)
IT-003-0048p-01 0.1 mg

HA1 (H3N2) (A/Sydney/5/97)

Sign In for Pricing
View Details
HA1 (H3N2) (A/Sydney/5/97)
IT-003-0048p-02 1 mg

HA1 (H3N2) (A/Sydney/5/97)

Sign In for Pricing
View Details