Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADORA3 Peptide - C-terminal region

ADORA3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

A3AR, AD026, bA552M11.5, RP11-552M11.7

UniProt

Q5QNY7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADORA3 Rabbit Polyclonal Antibody (orb584523) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_001075445

Preservative

Lyophilized powder

AA Sequence

VLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYL3 Antibody
KC-19842-01 50 μL

MYL3 Antibody

Sign In for Pricing
View Details
MYL3 Antibody
KC-19842-02 100 µL

MYL3 Antibody

Sign In for Pricing
View Details
MYL3 Antibody
KC-19842-03 1 mL

MYL3 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS714903 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Tle1 Rabbit Polyclonal Antibody
TA363717 100 µL

Tle1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD35 / CR1 (CR1/802), CF594 conjugate, 0.1mg/mL
BNC940802-100 1x 100 µL

CD35 / CR1 (CR1/802), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details