Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADORA3 Peptide - C-terminal region

ADORA3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

A3AR, AD026, bA552M11.5, RP11-552M11.7

UniProt

Q5QNY7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADORA3 Rabbit Polyclonal Antibody (orb584523) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_001075445

Preservative

Lyophilized powder

AA Sequence

VLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2-Chloropropan-2-yl)benzene
TRC-C429340-500MG 500 mg

(2-Chloropropan-2-yl)benzene

Sign In for Pricing
View Details
KPNA1 Antibody
KC-3262-01 50 μL

KPNA1 Antibody

Sign In for Pricing
View Details
KPNA1 Antibody
KC-3262-02 100 µL

KPNA1 Antibody

Sign In for Pricing
View Details
KPNA1 Antibody
KC-3262-03 1 mL

KPNA1 Antibody

Sign In for Pricing
View Details
Map4k1 Mouse Gene Knockout Kit (CRISPR)
KN309744RB 1 Kit

Map4k1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IZUMO3 activation kit by CRISPRa
GA119105 1 Kit

Human IZUMO3 activation kit by CRISPRa

Sign In for Pricing
View Details