Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADORA3 Peptide - C-terminal region

ADORA3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

A3AR, AD026, bA552M11.5, RP11-552M11.7

UniProt

P33765

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADORA3 Rabbit Polyclonal Antibody (orb584524) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065734

Preservative

Lyophilized powder

AA Sequence

DFTELIVTDDKGTLANDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SCIMP shRNA Plasmid
abx967786-01 150 µg

Human SCIMP shRNA Plasmid

Sign In for Pricing
View Details
Human SCIMP shRNA Plasmid
abx967786-02 300 µg

Human SCIMP shRNA Plasmid

Sign In for Pricing
View Details
CHRNA1 Protein Lysate
OCOA15821-20UG 20 µg

CHRNA1 Protein Lysate

Sign In for Pricing
View Details
Gentamycin (sulphate) powder, 10 g
BS-AB17.03010P 10 g

Gentamycin (sulphate) powder, 10 g

Sign In for Pricing
View Details
DDX50 Antibody
orb419710 100 µL

DDX50 Antibody

Sign In for Pricing
View Details
B4GALT2 siRNA (Human)
orb1862530-01 15 nmol

B4GALT2 siRNA (Human)

Sign In for Pricing
View Details