Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADPRH Peptide - C-terminal region

ADPRH Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARH1

UniProt

P54922

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADPRH Rabbit Polyclonal Antibody (orb581495) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001116

Preservative

Lyophilized powder

AA Sequence

STAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-EBMZ ELISA Kit
EGTE0128 96 Tests

Goat anti-EBMZ ELISA Kit

Sign In for Pricing
View Details
TNFSF18 (NM_005092) Human Recombinant Protein
TP721219L 500 µg

TNFSF18 (NM_005092) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Tenascin C (TNC)
MBS2012158-01 0.01 mg

Recombinant Tenascin C (TNC)

Sign In for Pricing
View Details
Recombinant Tenascin C (TNC)
MBS2012158-02 0.05 mg

Recombinant Tenascin C (TNC)

Sign In for Pricing
View Details
Recombinant Tenascin C (TNC)
MBS2012158-03 0.1 mg

Recombinant Tenascin C (TNC)

Sign In for Pricing
View Details
Recombinant Tenascin C (TNC)
MBS2012158-04 0.2 mg

Recombinant Tenascin C (TNC)

Sign In for Pricing
View Details