Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADPRH Peptide - C-terminal region

ADPRH Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARH1

UniProt

P54922

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADPRH Rabbit Polyclonal Antibody (orb581495) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001116

Preservative

Lyophilized powder

AA Sequence

STAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal EGFR Antibody (EGFR/8933R) [Alexa Fluor 750]
NBP3-24208AF750 0.1 mL

Rabbit Monoclonal EGFR Antibody (EGFR/8933R) [Alexa Fluor 750]

Sign In for Pricing
View Details
PDK1 Knockout HEK293 Polyclonal Cells
ARG12685 1 Million

PDK1 Knockout HEK293 Polyclonal Cells

Sign In for Pricing
View Details
Cimetidine
GP0061-5g 5 g

Cimetidine

Sign In for Pricing
View Details
WPM medium (without AGAR and sugar)
WP001 250 g

WPM medium (without AGAR and sugar)

Sign In for Pricing
View Details
Anti-C. tetani purified toxin IgG (tetanus shock toxin)
TTOX15-S 100 µL

Anti-C. tetani purified toxin IgG (tetanus shock toxin)

Sign In for Pricing
View Details
LSM4 siRNA (Mouse)
MBS827568-01 15 nmol

LSM4 siRNA (Mouse)

Sign In for Pricing
View Details