Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADRA1B Peptide - C-terminal region

ADRA1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

ADRA1, ALPHA1BAR

UniProt

P35368

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADRA1B Rabbit Polyclonal Antibody (orb584526) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000670

Preservative

Lyophilized powder

AA Sequence

YRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

First Strand cDNA Human Ovary
CH1012 30 Reactions

First Strand cDNA Human Ovary

Sign In for Pricing
View Details
HPV-16 (Human Papilloma Virus 16) (rHPV16L1/1058), CF405S conjugate, 0.1mg/mL
BNC042057-500 1x 500 µL

HPV-16 (Human Papilloma Virus 16) (rHPV16L1/1058), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PBEF / NAMPT Polyclonal Antibody
E-AB-60047-01 60 µL

PBEF / NAMPT Polyclonal Antibody

Sign In for Pricing
View Details
PBEF / NAMPT Polyclonal Antibody
E-AB-60047-02 120 µL

PBEF / NAMPT Polyclonal Antibody

Sign In for Pricing
View Details
PBEF / NAMPT Polyclonal Antibody
E-AB-60047-03 200 µL

PBEF / NAMPT Polyclonal Antibody

Sign In for Pricing
View Details
(3S,4E)-5-[2-Cyclopropyl-4-(4-fluorophenyl)-3-quinolinyl]-3-hydroxy-4-pentenoic acid Calcium
TRC-C661150-10MG 10 mg

(3S,4E)-5-[2-Cyclopropyl-4-(4-fluorophenyl)-3-quinolinyl]-3-hydroxy-4-pentenoic acid Calcium

Sign In for Pricing
View Details