Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADRA1B Peptide - C-terminal region

ADRA1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

ADRA1, ALPHA1BAR

UniProt

P35368

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADRA1B Rabbit Polyclonal Antibody (orb584526) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000670

Preservative

Lyophilized powder

AA Sequence

YRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP1B Polyclonal Antibody
E-AB-16086-01 20 µL

MAP1B Polyclonal Antibody

Sign In for Pricing
View Details
MAP1B Polyclonal Antibody
E-AB-16086-02 60 µL

MAP1B Polyclonal Antibody

Sign In for Pricing
View Details
MAP1B Polyclonal Antibody
E-AB-16086-03 120 µL

MAP1B Polyclonal Antibody

Sign In for Pricing
View Details
MAP1B Polyclonal Antibody
E-AB-16086-04 200 µL

MAP1B Polyclonal Antibody

Sign In for Pricing
View Details
P2Y6 (P2RY6) (NM_001277207) Human Tagged ORF Clone
RG237472 10 µg

P2Y6 (P2RY6) (NM_001277207) Human Tagged ORF Clone

Sign In for Pricing
View Details
RASSF4 Rabbit Polyclonal Antibody
TA364960 100 µL

RASSF4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details