Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADRA1B Peptide - N-terminal region

ADRA1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

ADRA1, ALPHA1BAR

UniProt

P35368

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADRA1B Rabbit Polyclonal Antibody (orb584527) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000670

Preservative

Lyophilized powder

AA Sequence

VWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF6 Polyclonal Antibody
JOT-AP13870-01 20 µL

RNF6 Polyclonal Antibody

Sign In for Pricing
View Details
RNF6 Polyclonal Antibody
JOT-AP13870-02 50 μL

RNF6 Polyclonal Antibody

Sign In for Pricing
View Details
RNF6 Polyclonal Antibody
JOT-AP13870-03 100 µL

RNF6 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Cercopithecus diana Melanocyte-stimulating hormone receptor (MC1R), partial
MBS7091175 Inquire

Recombinant Cercopithecus diana Melanocyte-stimulating hormone receptor (MC1R), partial

Sign In for Pricing
View Details
TTLL9 Protein Vector (Mouse) (pPM-C-HA)
PV242896 500 ng

TTLL9 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal CEACAM5/CD66e Antibody (COL-1) [PerCP]
NBP3-05767PCP 0.1 mL

Mouse Monoclonal CEACAM5/CD66e Antibody (COL-1) [PerCP]

Sign In for Pricing
View Details