What is the catalog number for ADRM1 Peptide - C-terminal region?

The catalog number for ADRM1 Peptide - C-terminal region is orb2011879.

What sizes are available for ADRM1 Peptide - C-terminal region?

ADRM1 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is ADRM1 Peptide - C-terminal region in stock?

ADRM1 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

ADRM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARM1, GP110, MGC29536, Rpn13

UniProt

Q16186

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_783163

Preservative

Lyophilized powder

AA Sequence

QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb1950448-01 50 µL

Histone H3 (acetyl K18) Rabbit mAb [KD Validated] Antibody

Sign In for Pricing

View Details

orb1950448-02 100 µL

Histone H3 (acetyl K18) Rabbit mAb [KD Validated] Antibody

Sign In for Pricing

View Details

A08233-1-iFluor647 100 µg

Anti-PTPN9 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing

View Details

bs-15488R-01 20 µL

HIG2 Polyclonal Antibody

Sign In for Pricing

View Details

bs-15488R-02 100 µL

HIG2 Polyclonal Antibody

Sign In for Pricing

View Details

250654-HRP 100 µL

PTH (Parathyroid Hormone, PTH1) (HRP)

Sign In for Pricing

View Details