Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADRM1 Peptide - C-terminal region

ADRM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARM1, GP110, MGC29536, Rpn13

UniProt

Q16186

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_783163

Preservative

Lyophilized powder

AA Sequence

QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish p63/TP63 Rabbit Polyclonal Antibody (APC)
orb3003688 100 µg

Zebrafish p63/TP63 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
EP Reagent Biuret Reagent
1011601 100 mL

EP Reagent Biuret Reagent

Sign In for Pricing
View Details
Mouse Human IgG2 (Fc subclass specific), conjugated with TRITC Antibody
orb22266 0.2 mg

Mouse Human IgG2 (Fc subclass specific), conjugated with TRITC Antibody

Sign In for Pricing
View Details
DAP3 (NM_033657) Human Recombinant Protein
TP323182M 100 µg

DAP3 (NM_033657) Human Recombinant Protein

Sign In for Pricing
View Details
anti-TAF1C
YF-PA16019 50 ug

anti-TAF1C

Sign In for Pricing
View Details
Recombinant Human VSIG4 Protein (His Tag)
PKSH033340-01 10 µg

Recombinant Human VSIG4 Protein (His Tag)

Sign In for Pricing
View Details