Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aff1 Peptide - N-terminal region

Aff1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

9630032B01Rik, AW319193, Af4, Mllt2h, Rob

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aff1 Rabbit Polyclonal Antibody (orb574020) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598680

Preservative

Lyophilized powder

AA Sequence

MAAHSSLYNEDRNLLRIREKERRNQEAHQEKEAFPEKAPLFPEPYKTAKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASSF2 Antibody, Biotin conjugated
CSB-PA019374LD01HU-01 50 μL

RASSF2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
RASSF2 Antibody, Biotin conjugated
CSB-PA019374LD01HU-02 100 µL

RASSF2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ALDH1A2 Protein Vector (Human) (pPB-His-MBP)
PV321138 500 ng

ALDH1A2 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
ZNRF3 shRNA (m) Lentiviral Particles
sc-155815-V 200 µL

ZNRF3 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Rabbit Polyclonal NOC3L Antibody
NBP2-58021-25ul 25 µL

Rabbit Polyclonal NOC3L Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CCL11/Eotaxin Antibody (43915) [Alexa Fluor 647]
FAB3201R 0.5 mL

Mouse Monoclonal CCL11/Eotaxin Antibody (43915) [Alexa Fluor 647]

Sign In for Pricing
View Details