Aff1 Peptide - N-terminal region
Aff1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
9630032B01Rik, AW319193, Af4, Mllt2h, Rob
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Aff1 Rabbit Polyclonal Antibody (orb574020) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_598680
Preservative
Lyophilized powder
AA Sequence
MAAHSSLYNEDRNLLRIREKERRNQEAHQEKEAFPEKAPLFPEPYKTAKG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2560905 3x 1.0 µg
TUFT1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 
H5205-05C 100 µg
Histone Methyltransferase, SUV39H1 (Histone-lysine N-methyltransferase, SUV39H1, Histone H3-K9 methyltransferase 1, H3-K9-HMTase 1, Full=Position-effect variegation 3-9 homolog, Suppressor of variegation 3-9 homolog 1, Su (var) 3-9 homolog 1) discontinued
Sign In for Pricing
View Details NBP3-06549MFV500 0.1 mL
Mouse Monoclonal PFDN2 Antibody (04) [mFluor Violet 500 SE]
Sign In for Pricing
View Details 
EK713506 96 Well
Human Ras-related protein Rab-3B (RAB3B) Elisa Kit
Sign In for Pricing
View Details 128174-Biotin 100 µL
Hyaluronoglucosaminidase 1 (HYAL1, Hyaluronidase-1, Hyal-1, LuCa-1, LUCA1, Hyaluronoglucosaminidase-1, Lung Carcinoma Protein 1) (Biotin)
Sign In for Pricing
View Details