Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aff3 Peptide - C-terminal region

Aff3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

3222402O04Rik, A730046J16, LAF-4, Laf4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aff3 Rabbit Polyclonal Antibody (orb576541) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034808

Preservative

Lyophilized powder

AA Sequence

TNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Schizosaccharomyces pombe GPI transamidase component PIG-T homolog (SPBC1604.15), partial
MBS1130749 Inquire

Recombinant Schizosaccharomyces pombe GPI transamidase component PIG-T homolog (SPBC1604.15), partial

Sign In for Pricing
View Details
TXNL4A Polyclonal Antibody
27302-01 50 µL

TXNL4A Polyclonal Antibody

Sign In for Pricing
View Details
TXNL4A Polyclonal Antibody
27302-02 100 µL

TXNL4A Polyclonal Antibody

Sign In for Pricing
View Details
Human ZNF655 Pre-designed siRNA Set B
SI018978B 1 Each

Human ZNF655 Pre-designed siRNA Set B

Sign In for Pricing
View Details
3- (3-Hydroxyphenyl) -2-thiophenecarboxylic acid
OR1007095 1 Each

3- (3-Hydroxyphenyl) -2-thiophenecarboxylic acid

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae CHMP3 Protein (aa 1-224) [His]
VAng-Wyb4393-1mg 1 mg

Recombinant Saccharomyces Cerevisiae CHMP3 Protein (aa 1-224) [His]

Sign In for Pricing
View Details