Aff3 Peptide - C-terminal region
Aff3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
3222402O04Rik, A730046J16, LAF-4, Laf4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Aff3 Rabbit Polyclonal Antibody (orb576541) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_034808
Preservative
Lyophilized powder
AA Sequence
TNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
338498-01 50 µg
UBASH3A (Ubiquitin-Associated and SH3 Domain-Containing Protein A, Cbl-interacting Protein 4, CLIP4, Suppressor of T-Cell Receptor Signaling 2, STS-2, T-Cell Ubiquitin Ligand 1, TULA-1, TULA1, STS2)
Sign In for Pricing
View Details 338498-02 100 µg
UBASH3A (Ubiquitin-Associated and SH3 Domain-Containing Protein A, Cbl-interacting Protein 4, CLIP4, Suppressor of T-Cell Receptor Signaling 2, STS-2, T-Cell Ubiquitin Ligand 1, TULA-1, TULA1, STS2)
Sign In for Pricing
View Details 