Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFM Peptide - C-terminal region

AFM Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALB2, ALBA, ALF, MGC125338, MGC125339

UniProt

P43652

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AFM Rabbit Polyclonal Antibody (orb574826) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001124

Preservative

Lyophilized powder

AA Sequence

HADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Progesterone Receptor (pS400) Antibody
MBS9240717-01 0.05 mL

Anti-Progesterone Receptor (pS400) Antibody

Sign In for Pricing
View Details
Anti-Progesterone Receptor (pS400) Antibody
MBS9240717-02 0.1 mL

Anti-Progesterone Receptor (pS400) Antibody

Sign In for Pricing
View Details
Anti-Progesterone Receptor (pS400) Antibody
MBS9240717-03 5x 0.1 mL

Anti-Progesterone Receptor (pS400) Antibody

Sign In for Pricing
View Details
Tefinostat
BA3079-50 50 mg

Tefinostat

Sign In for Pricing
View Details
Bub3 Polyclonal Antibody
BT-AP01011-01 20 µL

Bub3 Polyclonal Antibody

Sign In for Pricing
View Details
Bub3 Polyclonal Antibody
BT-AP01011-02 50 µL

Bub3 Polyclonal Antibody

Sign In for Pricing
View Details