Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFM Peptide - C-terminal region

AFM Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALB2, ALBA, ALF, MGC125338, MGC125339

UniProt

P43652

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AFM Rabbit Polyclonal Antibody (orb574826) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001124

Preservative

Lyophilized powder

AA Sequence

HADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LASS1 (LAG1 Homolog, Ceramide Synthase 1, CerS1, LAG1, MGC90349, UOG1) (MaxLight 750)
MBS6239132-01 0.1 mL

LASS1 (LAG1 Homolog, Ceramide Synthase 1, CerS1, LAG1, MGC90349, UOG1) (MaxLight 750)

Sign In for Pricing
View Details
LASS1 (LAG1 Homolog, Ceramide Synthase 1, CerS1, LAG1, MGC90349, UOG1) (MaxLight 750)
MBS6239132-02 5x 0.1 mL

LASS1 (LAG1 Homolog, Ceramide Synthase 1, CerS1, LAG1, MGC90349, UOG1) (MaxLight 750)

Sign In for Pricing
View Details
Mouse Glycogen synthase kinase-3 alpha, Gsk3a ELISA Kit
CK-bio-16276-01 48 Tests

Mouse Glycogen synthase kinase-3 alpha, Gsk3a ELISA Kit

Sign In for Pricing
View Details
Mouse Glycogen synthase kinase-3 alpha, Gsk3a ELISA Kit
CK-bio-16276-02 96 Tests

Mouse Glycogen synthase kinase-3 alpha, Gsk3a ELISA Kit

Sign In for Pricing
View Details
Mouse Glycogen synthase kinase-3 alpha, Gsk3a ELISA Kit
CK-bio-16276-03 5x 96 Tests

Mouse Glycogen synthase kinase-3 alpha, Gsk3a ELISA Kit

Sign In for Pricing
View Details
Mouse Glycogen synthase kinase-3 alpha, Gsk3a ELISA Kit
CK-bio-16276-04 10x 96 Tests

Mouse Glycogen synthase kinase-3 alpha, Gsk3a ELISA Kit

Sign In for Pricing
View Details