Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGA Peptide - middle region

AGA Peptide - middle region

Product Specifications

Product Name Alternative

AGU, ASRG, GA

UniProt

P20933

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AGA Rabbit Polyclonal Antibody (orb584880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001165459

Preservative

Lyophilized powder

AA Sequence

SMGFINEDLSTTASQALHSDWLARNCQPNYWRNVIPDPSKYCGPYKPPGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNG (Interferon, gamma, IFG, IFI)
247457 50 µL

IFNG (Interferon, gamma, IFG, IFI)

Sign In for Pricing
View Details
Amplirun® Borrelia Garinii DNA Control
MBC077 1 Vial - 10000-20000 Copies/µL

Amplirun® Borrelia Garinii DNA Control

Sign In for Pricing
View Details
HSP90AB1 Rabbit pAb
MBS8544226-01 0.1 mL

HSP90AB1 Rabbit pAb

Sign In for Pricing
View Details
HSP90AB1 Rabbit pAb
MBS8544226-02 0.1 mL (AF405L)

HSP90AB1 Rabbit pAb

Sign In for Pricing
View Details
HSP90AB1 Rabbit pAb
MBS8544226-03 0.1 mL (AF405S)

HSP90AB1 Rabbit pAb

Sign In for Pricing
View Details
HSP90AB1 Rabbit pAb
MBS8544226-04 0.1 mL (AF610)

HSP90AB1 Rabbit pAb

Sign In for Pricing
View Details