Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGK Peptide - N-terminal region

AGK Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ10842, MULK, MTDPS10

UniProt

Q53H12

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AGK Rabbit Polyclonal Antibody (orb330918) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060708

Preservative

Lyophilized powder

AA Sequence

KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5T4 (TPBG) (NM_006670) Human Recombinant Protein
TP303484L 1 mg

5T4 (TPBG) (NM_006670) Human Recombinant Protein

Sign In for Pricing
View Details
SAE1 Mouse Monoclonal Antibody [Clone ID: OTI6C7]
CF805142 100 µg

SAE1 Mouse Monoclonal Antibody [Clone ID: OTI6C7]

Sign In for Pricing
View Details
NHEDC2 (SLC9B2) Human qPCR Primer Pair (NM_178833)
HP218910 200 Reactions

NHEDC2 (SLC9B2) Human qPCR Primer Pair (NM_178833)

Sign In for Pricing
View Details
Human VSIG10L activation kit by CRISPRa
GA115611 1 Kit

Human VSIG10L activation kit by CRISPRa

Sign In for Pricing
View Details
CHFR (NM_001161344) Human Over-expression Lysate
LY431554 100 µg

CHFR (NM_001161344) Human Over-expression Lysate

Sign In for Pricing
View Details
Human GLT8D2 activation kit by CRISPRa
GA113181 1 Kit

Human GLT8D2 activation kit by CRISPRa

Sign In for Pricing
View Details