Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGMAT Peptide - N-terminal region

AGMAT Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ23384

UniProt

Q9BSE5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AGMAT Rabbit Polyclonal Antibody (orb585234) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079034

Preservative

Lyophilized powder

AA Sequence

FVARPVGVCSMMRLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PTEN (Y176) Blocking Peptide
MBS9231545-01 0.5 mg

Phospho-PTEN (Y176) Blocking Peptide

Sign In for Pricing
View Details
Phospho-PTEN (Y176) Blocking Peptide
MBS9231545-02 5x 0.5 mg

Phospho-PTEN (Y176) Blocking Peptide

Sign In for Pricing
View Details
Mouse IgM
31C-CH1025 1 mg

Mouse IgM

Sign In for Pricing
View Details
Immunoglobulin G Depleted Processed Serum
B2014156 5 mL

Immunoglobulin G Depleted Processed Serum

Sign In for Pricing
View Details
GTSE1 Rabbit Polyclonal Antibody
E28PN0204 100 µL

GTSE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR8J3 sgRNA CRISPR Lentivector (Human) (Target 1)
K1545402 1.0 µg DNA

OR8J3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details