Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGPAT3 Peptide - middle region

AGPAT3 Peptide - middle region

Product Specifications

Product Name Alternative

LPAAT-GAMMA1, MGC4604

UniProt

Q9NRZ7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AGPAT3 Rabbit Polyclonal Antibody (orb584807) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064517

Preservative

Lyophilized powder

AA Sequence

KRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cfap100 shRNA (UAS) - Lentiviral mouse Cfap100 shRNA (UAS, RFP) (100)
GTR15137580 1 Vial

Lentiviral mouse Cfap100 shRNA (UAS) - Lentiviral mouse Cfap100 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
IGF‑I / IGF-1 protein
M60-118-L1000 1000 µg

IGF‑I / IGF-1 protein

Sign In for Pricing
View Details
DIRAS1 Double Nickase Plasmid (h2)
sc-410330-NIC-2 20 µg

DIRAS1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Mouse Monoclonal CEACAM5/CD66e Antibody (C66/195) [Alexa Fluor 750]
NBP2-47973AF750 0.1 mL

Mouse Monoclonal CEACAM5/CD66e Antibody (C66/195) [Alexa Fluor 750]

Sign In for Pricing
View Details
CD80 (B7-1) (C80/1608), CF640R conjugate, 0.1mg/mL
BNC401608-100 1x 100 µL

CD80 (B7-1) (C80/1608), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL28B (IFNL3) (NM_172139) Human Recombinant Protein
TP318965SE 20 µg

IL28B (IFNL3) (NM_172139) Human Recombinant Protein

Sign In for Pricing
View Details