AGPAT4 Peptide - middle region
AGPAT4 Peptide - middle region
Product Specifications
Product Name Alternative
1-AGPAT4, LPAAT-delta, dJ473J16.2, RP3-473J16.2
UniProt
Q9NRZ5
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AGPAT4 Rabbit Polyclonal Antibody (orb584820) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_064518
Preservative
Lyophilized powder
AA Sequence
EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB0252-100 1x 100 µL
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
NKD-H5257-100ug 100 µg
Human NKG2D / CD314 Protein, Llama IgG2b Fc Tag, low endotoxin
Sign In for Pricing
View Details 