Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGPAT4 Peptide - middle region

AGPAT4 Peptide - middle region

Product Specifications

Product Name Alternative

1-AGPAT4, LPAAT-delta, dJ473J16.2, RP3-473J16.2

UniProt

Q9NRZ5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AGPAT4 Rabbit Polyclonal Antibody (orb584820) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064518

Preservative

Lyophilized powder

AA Sequence

EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIR3DL1 Antibody
KC-3520-01 50 μL

KIR3DL1 Antibody

Sign In for Pricing
View Details
KIR3DL1 Antibody
KC-3520-02 100 µL

KIR3DL1 Antibody

Sign In for Pricing
View Details
KIR3DL1 Antibody
KC-3520-03 1 mL

KIR3DL1 Antibody

Sign In for Pricing
View Details
(2S,3S,4R,5S)-2,3,4,5,6-Pentahydroxy-N-(1-phenylpropan-2-yl)hexanamide
TRC-P218265-250MG 250 mg

(2S,3S,4R,5S)-2,3,4,5,6-Pentahydroxy-N-(1-phenylpropan-2-yl)hexanamide

Sign In for Pricing
View Details
SPATA24 (NM_194296) Human Over-expression Lysate
LY430677 100 µg

SPATA24 (NM_194296) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse BTNL2/Butyrophilin-like Protein 2 Protein (His Tag)
PKSM041354-01 10 µg

Recombinant Mouse BTNL2/Butyrophilin-like Protein 2 Protein (His Tag)

Sign In for Pricing
View Details