Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPAT3 Peptide - middle region

GPAT3 Peptide - middle region

Product Specifications

Product Name Alternative

Agpat9

UniProt

Q4V8J4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPAT3 Rabbit Polyclonal Antibody (orb580978) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020841

Preservative

Lyophilized powder

AA Sequence

CRICVRSLSGTIHYHNKQYRPQKGGICVANHTSPIDVLILATDGCYAMVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 S1 (Biotinylated, Omicron, B.1.1.529, HEK293, His-Avi)
HY-P77635 1 Each

SARS-CoV-2 S1 (Biotinylated, Omicron, B.1.1.529, HEK293, His-Avi)

Sign In for Pricing
View Details
H2bu1-ps Mouse siRNA Oligo Duplex (Locus ID 382522)
SR402065 1 Kit

H2bu1-ps Mouse siRNA Oligo Duplex (Locus ID 382522)

Sign In for Pricing
View Details
Recombinant Human TIMM21
orb1714511-01 50 µg

Recombinant Human TIMM21

Sign In for Pricing
View Details
Recombinant Human TIMM21
orb1714511-02 100 µg

Recombinant Human TIMM21

Sign In for Pricing
View Details
Recombinant Human TIMM21
orb1714511-03 200 µg

Recombinant Human TIMM21

Sign In for Pricing
View Details
Recombinant Human TIMM21
orb1714511-04 1 mg

Recombinant Human TIMM21

Sign In for Pricing
View Details