Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPAT3 Peptide - middle region

GPAT3 Peptide - middle region

Product Specifications

Product Name Alternative

Agpat9

UniProt

Q4V8J4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPAT3 Rabbit Polyclonal Antibody (orb580978) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020841

Preservative

Lyophilized powder

AA Sequence

CRICVRSLSGTIHYHNKQYRPQKGGICVANHTSPIDVLILATDGCYAMVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRBJ1-4 sgRNA CRISPR Lentivector (Human) (Target 2)
K2448503 1.0 µg DNA

TRBJ1-4 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Cth 3'UTR Lenti-reporter-Luc Vector
17062084 1.0 µg

Cth 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Kvbeta1.1 K+ channel Antibody
ANT-36614-100ug 100 µg

Kvbeta1.1 K+ channel Antibody

Sign In for Pricing
View Details
LAT antibody
70R-18220 50 μL

LAT antibody

Sign In for Pricing
View Details
S100-A6 Antibody
E38PA9820 100 µL

S100-A6 Antibody

Sign In for Pricing
View Details
OAS2 (NM_002535) Human 3' UTR Clone
SC214628 10 µg

OAS2 (NM_002535) Human 3' UTR Clone

Sign In for Pricing
View Details