Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGTPBP1 Peptide - N-terminal region

AGTPBP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686M20191, KIAA1035, NNA1, CCP1

UniProt

Q9UPW5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AGTPBP1 Rabbit Polyclonal Antibody (orb582668) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056054

Preservative

Lyophilized powder

AA Sequence

KAFIDANGMKILYNTSQLPVIPVTGPVAQLYSLPPEVDDVVDESDDNDDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-2 (Interleukin 2) ELISA Kit
E-EL-H0099-01 24 Tests

Human IL-2 (Interleukin 2) ELISA Kit

Sign In for Pricing
View Details
Human IL-2 (Interleukin 2) ELISA Kit
E-EL-H0099-02 48 Tests

Human IL-2 (Interleukin 2) ELISA Kit

Sign In for Pricing
View Details
Human IL-2 (Interleukin 2) ELISA Kit
E-EL-H0099-03 96 Tests

Human IL-2 (Interleukin 2) ELISA Kit

Sign In for Pricing
View Details
Thrombomodulin (THBD) Mouse Monoclonal Antibody [Clone ID: B-A35]
AM31356FC-N 1 mL (100 Tests)

Thrombomodulin (THBD) Mouse Monoclonal Antibody [Clone ID: B-A35]

Sign In for Pricing
View Details
Sterol carrier protein 2 (SCP2) (NM_001007100) Human Recombinant Protein
TP318251 20 µg

Sterol carrier protein 2 (SCP2) (NM_001007100) Human Recombinant Protein

Sign In for Pricing
View Details
Tubd1 Mouse Gene Knockout Kit (CRISPR)
KN518474 1 Kit

Tubd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details