Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGTR2 Peptide - N-terminal region

AGTR2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AT2, ATGR2, MRX88

UniProt

P50052

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AGTR2 Rabbit Polyclonal Antibody (orb584534) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000677

Preservative

Lyophilized powder

AA Sequence

LHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MARS2 siRNA
abx923585-01 15 nmol

Mouse MARS2 siRNA

Sign In for Pricing
View Details
Mouse MARS2 siRNA
abx923585-02 30 nmol

Mouse MARS2 siRNA

Sign In for Pricing
View Details
LZTS2 (NM_032429) Human Over-expression Lysate
LS084445-100ug 100 µg

LZTS2 (NM_032429) Human Over-expression Lysate

Sign In for Pricing
View Details
FOXK2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0797506 1.0 µg DNA

FOXK2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
SCAND1 Human Pre-designed siRNA Set A
HY-RS12483 1 Set

SCAND1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
T-bet/TBX21 (E4I2K) & CO-0077-647 SignalStar™ Oligo-Antibody Pair
CST 52418S 1 Kit

T-bet/TBX21 (E4I2K) & CO-0077-647 SignalStar™ Oligo-Antibody Pair

Sign In for Pricing
View Details