Ahcy Peptide - N-terminal region
Ahcy Peptide - N-terminal region
Product Specifications
Product Name Alternative
AA987153, AL024110, CuBP, MGC102079, MGC118063, MGC19228, SAHH
UniProt
P50247
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ahcy Rabbit Polyclonal Antibody (orb581438) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057870
Preservative
Lyophilized powder
AA Sequence
TNLIHTKYPQLLSGIRGISEETTTGVHNLYKMMSNGILKVPAINVNDSVT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741857-500 1x 500 µL
Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881712-500 1x 500 µL
GP2 (Glycoprotein 2) / ZAP75 (GP2/1712), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740484-500 1x 500 µL
Progesterone Receptor (PR484), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details