Ahi1 Peptide - C-terminal region
Ahi1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Ahi-1, Ahi1
UniProt
Q6DTM3
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ahi1 Rabbit Polyclonal Antibody (orb583405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001002277
Preservative
Lyophilized powder
AA Sequence
KDSTLRIMDLRILAARKFVGAANYREKIHSTLTPCGTLLFSGSEDGIVYV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2471989 100 µL
TST/Thiosulfate sulfurtransferase Rabbit Polyclonal Antibody (BF594)
Sign In for Pricing
View Details 
MBS8433927-01 0.1 mg
Mouse Serum Albumin Recombinant Protein His Tag Lyophilized
Sign In for Pricing
View Details MBS8433927-02 5x 0.1 mg
Mouse Serum Albumin Recombinant Protein His Tag Lyophilized
Sign In for Pricing
View Details 