Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ahi1 Peptide - C-terminal region

Ahi1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Ahi-1, Ahi1

UniProt

Q6DTM3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ahi1 Rabbit Polyclonal Antibody (orb583405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001002277

Preservative

Lyophilized powder

AA Sequence

KDSTLRIMDLRILAARKFVGAANYREKIHSTLTPCGTLLFSGSEDGIVYV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUFU Over-expression Lysate Product
GWB-196C07 0.1 mg

SUFU Over-expression Lysate Product

Sign In for Pricing
View Details
Rat Sphingosine 1 Phosphate Receptor 3 (S1PR3) ELISA Kit
MBS2705579-01 24 Strip Well

Rat Sphingosine 1 Phosphate Receptor 3 (S1PR3) ELISA Kit

Sign In for Pricing
View Details
Rat Sphingosine 1 Phosphate Receptor 3 (S1PR3) ELISA Kit
MBS2705579-02 48 Well

Rat Sphingosine 1 Phosphate Receptor 3 (S1PR3) ELISA Kit

Sign In for Pricing
View Details
Rat Sphingosine 1 Phosphate Receptor 3 (S1PR3) ELISA Kit
MBS2705579-03 96 Well

Rat Sphingosine 1 Phosphate Receptor 3 (S1PR3) ELISA Kit

Sign In for Pricing
View Details
Rat Sphingosine 1 Phosphate Receptor 3 (S1PR3) ELISA Kit
MBS2705579-04 5x 96 Well

Rat Sphingosine 1 Phosphate Receptor 3 (S1PR3) ELISA Kit

Sign In for Pricing
View Details
Rat Sphingosine 1 Phosphate Receptor 3 (S1PR3) ELISA Kit
MBS2705579-05 10x 96 Well

Rat Sphingosine 1 Phosphate Receptor 3 (S1PR3) ELISA Kit

Sign In for Pricing
View Details