Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ahrr Peptide - middle region

Ahrr Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1234, mKIAA1234

UniProt

Q3U1U7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ahrr Rabbit Polyclonal Antibody (orb576177) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033774

Preservative

Lyophilized powder

AA Sequence

CLRGGPDLLDPKGTSGDREEEDQKHILRRSPGAWGQREMHKYSYGLETPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Mouse IL-17A Antibody
RD30499F-01 25 µg

FITC Anti-Mouse IL-17A Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse IL-17A Antibody
RD30499F-02 100 µg

FITC Anti-Mouse IL-17A Antibody

Sign In for Pricing
View Details
CCDC102A Rabbit Polyclonal Antibody
TA367949 100 µL

CCDC102A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
10,11-Dehydroxy Limaprost (>85%) Sodium Salt
TRC-D230525-1MG 1 mg

10,11-Dehydroxy Limaprost (>85%) Sodium Salt

Sign In for Pricing
View Details
CMV TaqMan PCR Kit
TM36350 100 Reactions

CMV TaqMan PCR Kit

Sign In for Pricing
View Details
CTDSPL (NM_001008392) Human Over-expression Lysate
LY423419 100 µg

CTDSPL (NM_001008392) Human Over-expression Lysate

Sign In for Pricing
View Details